PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000707539
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 247aa    MW: 26649 Da    PI: 8.4796
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000707539genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.11.6e-3290147259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  MDP0000707539  90 EDGYRWRKYGQKAVKNSPFPRSYYRCTNTKCTVKKRVERSSEDPTTVITTYEGQHCHH 147
                    8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-3374148IPR003657WRKY domain
SuperFamilySSF1182903.92E-2881147IPR003657WRKY domain
PROSITE profilePS5081129.67784149IPR003657WRKY domain
SMARTSM007746.6E-3889148IPR003657WRKY domain
PfamPF031062.7E-2590147IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSDLAGNTSS SPLVLENSSS SSSPAFRSSD LAPVVGSAST NQSASTSSSE DPPEXSAGSG  60
GKPPPEIQGP KRIRQQRFAF VTKSEVDHLE DGYRWRKYGQ KAVKNSPFPR SYYRCTNTKC  120
TVKKRVERSS EDPTTVITTY EGQHCHHTVA FPRGGVIGHE SGFAGHXLAQ LSPASHFMYY  180
PTIRPREITS PINLTPTASH QAVVRRHDDD QAAGGSSHFI DPQPTPPLPT DEGLLGDIVP  240
PGMRNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-26821461074Probable WRKY transcription factor 4
2lex_A3e-26821461074Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356380.11e-150PREDICTED: probable WRKY transcription factor 57 isoform X1
SwissprotQ9C9832e-61WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLM5XCG61e-115M5XCG6_PRUPE; Uncharacterized protein
STRINGVIT_01s0011g00720.t013e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108143140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-55WRKY DNA-binding protein 57